DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4G2 and AT1G62410

DIOPT Version :9

Sequence 1:NP_001287489.1 Gene:eIF4G2 / 42819 FlyBaseID:FBgn0260634 Length:2072 Species:Drosophila melanogaster
Sequence 2:NP_176431.1 Gene:AT1G62410 / 842539 AraportID:AT1G62410 Length:223 Species:Arabidopsis thaliana


Alignment Length:215 Identity:61/215 - (28%)
Similarity:94/215 - (43%) Gaps:48/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1313 LIFEKTISEPNFAPTYARFCKVLFHEI--------KAENKSLFTSSLITRIQHEFESNVNDANAK 1369
            |||:|.:.||.|.|.||:.|..:.|::        |.:..| |...|:...|..||         
plant    16 LIFDKAVLEPTFCPMYAQLCFDIRHKMPRFPPSAPKTDEIS-FKRVLLNTCQKVFE--------- 70

  Fly  1370 SKKLQPTMERINQCSDPAKKAELRAEMEDLEYQFRRRAWGTVRFIGELFKLQSLTNDRVLNCVES 1434
              :.....|.|.:.:.|.::||...|:..|..    |..|.:||.||||..:.||...||...:.
plant    71 --RTDDLSEEIRKMNAPDQEAEREDEVRLLNL----RTLGNLRFCGELFLKRMLTEKVVLAIGQK 129

  Fly  1435 LLEHG---C--EEKLEYMCKLLTTVGHLLESSLPEHYQLRDRI-EKIFRRIQDIINRSRGTSHRQ 1493
            |||..   |  |||:..:|..|.|||..|:|       |..:: .:|.||::::.|         
plant   130 LLEDAEQMCPSEEKIIAICLFLNTVGKKLDS-------LNSKLMNEILRRLKNLSN--------- 178

  Fly  1494 QVHIKISSRVRFMMQDVLDL 1513
              |.::...:|.|:..::.|
plant   179 --HPQLVMSLRLMVGKIIHL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4G2NP_001287489.1 EIN3 <270..423 CDD:296674
MIF4G 1274..1514 CDD:280935 61/215 (28%)
MA3 1697..1812 CDD:280933
AT1G62410NP_176431.1 MIF4G 9..198 CDD:214713 61/215 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0401
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.