DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup98-96 and si:ch211-216l23.2

DIOPT Version :9

Sequence 1:NP_001262885.1 Gene:Nup98-96 / 42816 FlyBaseID:FBgn0039120 Length:1960 Species:Drosophila melanogaster
Sequence 2:NP_001038534.1 Gene:si:ch211-216l23.2 / 565061 ZFINID:ZDB-GENE-030131-3806 Length:474 Species:Danio rerio


Alignment Length:307 Identity:65/307 - (21%)
Similarity:105/307 - (34%) Gaps:77/307 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1360 KGNEGFRESIIP--------HLEVQLNDCLSVNVEGSECPCIHPDSGTKLVS-KHFSESLKQRNA 1415
            |.|:.||....|        ||:::....|...::.|           .:|. :|.|..:....:
Zfish    22 KSNKSFRRPPYPVRQERTEEHLQLESFQSLEETIDYS-----------SIVDYEHSSHKITGLPS 75

  Fly  1416 GLKEDYSVSVWSLLFALWGDHDELVDLEKNSHYMVMCRRNLLSEWLENTLLGKDLLSKKVSTHSY 1480
            ..:|.|.||.         .|.||.:    ..|..:|.        |:.....|.:...|:... 
Zfish    76 ASREQYDVST---------QHPELYE----RFYQQLCG--------ESARRPADCVVLSVNNQD- 118

  Fly  1481 LEHMLDLLSC-HRVNEACELAFSYDDANLALVLSQL-SSGAVFRLLMEEQLFAWQQSKSDKYIDL 1543
            :|:...|..| ..:....|:.:...::.|...|..: |.|:.|.:|:|:....  .|.....|..
Zfish   119 VEYPKSLGQCLQELGLTVEMLYLQSESGLTRALQDVRSDGSPFCILVEQTNVT--LSSCTVIIFS 181

  Fly  1544 ERLKMYMLAAGAPMMQSSHGAINLLENKNWLTALALQLWYFTAPTSSITDALNAYNDAFQAEEC- 1607
            |.||::.      .|...| |:..:     ||....|        ||...|||....|.:|.|. 
Zfish   182 ESLKIHR------NMPKEH-AMEFV-----LTEYGRQ--------SSPQRALNPTEAATRAAELT 226

  Fly  1608 --YAEPPKPSYRDAPTDTKKPVYDLRYHLLQLHSKRMHSLEETLNPI 1652
              |.|..|......|..|:        |||.|.::.:|...|.::.:
Zfish   227 EDYLERGKLERHTVPFTTR--------HLLFLLAEGLHLYPEEVSTL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup98-96NP_001262885.1 Nucleoporin_FG 395..481 CDD:316182
Nucleoporin2 888..1027 CDD:309287
Nup96 1484..1762 CDD:314912 40/174 (23%)
Nucleoporin_FG <1..74 CDD:316182
Nucleoporin_FG 50..164 CDD:316182
Nucleoporin_FG 254..318 CDD:316182
NupH_GANP 316..>522 CDD:318883
si:ch211-216l23.2NP_001038534.1 PHA03307 280..>471 CDD:223039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.