DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup98-96 and Ncoa5

DIOPT Version :9

Sequence 1:NP_001262885.1 Gene:Nup98-96 / 42816 FlyBaseID:FBgn0039120 Length:1960 Species:Drosophila melanogaster
Sequence 2:NP_001100013.1 Gene:Ncoa5 / 296372 RGDID:1307702 Length:578 Species:Rattus norvegicus


Alignment Length:211 Identity:55/211 - (26%)
Similarity:75/211 - (35%) Gaps:70/211 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KPAAPAFGNTSTFAAQPAQQSLF------GAAATPAQPA---------------GGLFGANTSTG 80
            :|...|.|  |:...||:.|.|.      .|..|||.|.               .|...||:|:.
  Rat   388 QPLGAASG--SSLKTQPSSQPLQSGQVLPSATPTPAAPPTSQQELQAKILSLFNSGAVAANSSSA 450

  Fly    81 FGSTATA----QPTAFGAFSQPQQTSNIFGSTQTAASTSLFGQSTLPAFGAAKPTMTAFGQTAAA 141
            ..|.||.    |..:..|.|||||.....|:    ...::.||:     |:|:    ..|....|
  Rat   451 SPSVATGSSQNQNFSTAANSQPQQRPQASGN----QPPNIVGQA-----GSAR----NMGPRPGA 502

  Fly   142 QPTGSLFGQPAAATSTTGFGGFGTSAPTTTNVFGSGTASAFAQPQATAVGASGVN-TGTAVAKYQ 205
             |:..|||||:                       |..|.|........|.::|:| ...:|.|  
  Rat   503 -PSQGLFGQPS-----------------------SRLAPASNMASQRPVSSTGINFDNPSVQK-- 541

  Fly   206 PTIGTDTLMKSGQANS 221
               ..|||::||.|.|
  Rat   542 ---ALDTLIQSGPALS 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup98-96NP_001262885.1 Nucleoporin_FG 395..481 CDD:316182
Nucleoporin2 888..1027 CDD:309287
Nup96 1484..1762 CDD:314912
Nucleoporin_FG <1..74 CDD:316182 14/57 (25%)
Nucleoporin_FG 50..164 CDD:316182 36/138 (26%)
Nucleoporin_FG 254..318 CDD:316182
NupH_GANP 316..>522 CDD:318883
Ncoa5NP_001100013.1 HisS <185..255 CDD:223202
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.