DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup98-96 and Ncoa5

DIOPT Version :9

Sequence 1:NP_001262885.1 Gene:Nup98-96 / 42816 FlyBaseID:FBgn0039120 Length:1960 Species:Drosophila melanogaster
Sequence 2:NP_659141.1 Gene:Ncoa5 / 228869 MGIID:2385165 Length:579 Species:Mus musculus


Alignment Length:209 Identity:58/209 - (27%)
Similarity:83/209 - (39%) Gaps:66/209 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KPAAPAFGNT--STFAAQPAQ--QSLFGAAATPAQPA---------------GGLFGANTSTGFG 82
            :|...|.|::  |..::||.|  |.|..|..|||.|.               .|...||:|:...
Mouse   389 QPLGAASGSSLKSQPSSQPLQSGQVLPSATPTPAAPPTSQQELQAKILSLFNSGAVAANSSSASP 453

  Fly    83 STATA----QPTAFGAFSQPQQTSNIFGSTQTAASTSLFGQSTLPAFGAAKPTMTAFGQTAAAQP 143
            |.||.    |..:..|.|||||.....|:    ...::.||:     |:|:    ..|....| |
Mouse   454 SVATGSSQNQNFSTAANSQPQQRPQASGN----QPPNIVGQA-----GSAR----NMGPRPGA-P 504

  Fly   144 TGSLFGQPAAATSTTGFGGFGTSAPTTTNVFGSGTASAFAQPQATAVGASGVN-TGTAVAKYQPT 207
            :..|||||::..           ||.:|        .|..:|    |.::|:| ...:|.|    
Mouse   505 SQGLFGQPSSRL-----------APAST--------MASQRP----VSSTGINFDNPSVQK---- 542

  Fly   208 IGTDTLMKSGQANS 221
             ..|||::||.|.|
Mouse   543 -ALDTLIQSGPALS 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup98-96NP_001262885.1 Nucleoporin_FG 395..481 CDD:316182
Nucleoporin2 888..1027 CDD:309287
Nup96 1484..1762 CDD:314912
Nucleoporin_FG <1..74 CDD:316182 15/55 (27%)
Nucleoporin_FG 50..164 CDD:316182 37/134 (28%)
Nucleoporin_FG 254..318 CDD:316182
NupH_GANP 316..>522 CDD:318883
Ncoa5NP_659141.1 Transcription repression 1..158
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 148..172
HisS <186..256 CDD:223202
LXXLL motif 345..349
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..428 14/38 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 446..529 31/119 (26%)
Transcription activation 458..579 37/140 (26%)
PRK14971 <459..>543 CDD:237874 30/125 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.