DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tst and AT3G46960

DIOPT Version :10

Sequence 1:NP_524465.1 Gene:tst / 42813 FlyBaseID:FBgn0039117 Length:1197 Species:Drosophila melanogaster
Sequence 2:NP_190280.5 Gene:AT3G46960 / 823849 AraportID:AT3G46960 Length:1347 Species:Arabidopsis thaliana


Alignment Length:32 Identity:10/32 - (31%)
Similarity:15/32 - (46%) Gaps:3/32 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FPQKASAWAL---KSNDAYGDSNNNNHPDRRR 43
            |..|...:||   :|.:|.|......:.:|||
plant   440 FRSKVRNYALAADESPNAIGQEEKQQYKERRR 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tstNP_524465.1 Ski2_N 33..143 CDD:465562 3/11 (27%)
Dob10 258..>755 CDD:443638
rRNA_proc-arch 713..999 CDD:463813
DSHCT 1025..1188 CDD:462374
AT3G46960NP_190280.5 Ski2_N 78..224 CDD:465562
Dob10 338..1337 CDD:443638 10/32 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.