DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10375 and DNAJC14

DIOPT Version :9

Sequence 1:NP_651185.1 Gene:CG10375 / 42812 FlyBaseID:FBgn0039116 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001381616.1 Gene:DNAJC14 / 85406 HGNCID:24581 Length:702 Species:Homo sapiens


Alignment Length:152 Identity:46/152 - (30%)
Similarity:73/152 - (48%) Gaps:19/152 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PSQQIDRLL-RPGSTYFNLNPFEVLQIEPEVELADIKKRYRTLSILVHPDKNPDNQERAQMAFDI 99
            |.:::.||| ..|.....||||.||.:|......::||.||.|:::||||||  :..||:.||.:
Human   424 PEEEVARLLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQLAVMVHPDKN--HHPRAEEAFKV 486

  Fly   100 VSRSWKILENELTRKRCLEVYEEAKGRTDQMIAEKRKKLKKEGRPTEPIPEDDPTKYKHAIYVMV 164
            :..:|.|:.|...||. .|:...|:....:.:.|...||           :||   .|.|:..|:
Human   487 LRAAWDIVSNAEKRKE-YEMKRMAENELSRSVNEFLSKL-----------QDD---LKEAMNTMM 536

  Fly   165 MKLFADMERRRQKLDQRDQEER 186
            ... ...:.||.::|:..:..|
Human   537 CSR-CQGKHRRFEMDREPKSAR 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10375NP_651185.1 DnaJ 54..109 CDD:99751 23/54 (43%)
DNAJC14NP_001381616.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..148
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..229
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 658..702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.