DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10375 and AT1G65280

DIOPT Version :9

Sequence 1:NP_651185.1 Gene:CG10375 / 42812 FlyBaseID:FBgn0039116 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001323409.1 Gene:AT1G65280 / 842835 AraportID:AT1G65280 Length:588 Species:Arabidopsis thaliana


Alignment Length:260 Identity:58/260 - (22%)
Similarity:105/260 - (40%) Gaps:72/260 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QQIDRLLRPGSTYFNLNPFEVLQIEPEVELADIKKRYRTLSILVHPDKNPDNQERAQMAFDIVSR 102
            :::.|::...:.    :|::||.:...:...::||||..||:||||||  .:..:||.||.::::
plant   293 EEVTRIMEADAN----SPYDVLGVNHNMAADNMKKRYWKLSLLVHPDK--CSHPQAQEAFVLLNK 351

  Fly   103 SWKILENELTRKRC---LEVYEEAKG-----RTDQMIAEKRKK--LKKEG-------RPTEPIPE 150
            ::|.|::...||..   :::.||.:.     |:.|..|:.|:.  :..||       ...:|.|:
plant   352 AFKELQDPEKRKAMDDKIKLKEEQEAFKVELRSMQEAAQWRRSQGISMEGDAELLAATEVKPEPK 416

  Fly   151 DD------PTKYKHAIYVMVMKLFADMER-----------------RRQKLD------------Q 180
            .|      |.:.|..:.|.....|:...|                 .|.|::            .
plant   417 RDEWMTTLPPERKVGVAVQQSTTFSRNAREGRGDTTAWTDTPMDKAERAKMNYLEAYNKASALAS 481

  Fly   181 RDQEERKRKRETEI----EEEERIKADREWQQNFEESRQSRVNSWHDFQSGAGKSKKAKKQKHMT 241
            .:.|..||..:.|:    .:|:|.|:..|..:....|..||:.          |.||....|..|
plant   482 NEGENMKRSMDAELVDKYNKEKRAKSLVEKHREDSSSSSSRLK----------KKKKLSSSKEKT 536

  Fly   242  241
            plant   537  536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10375NP_651185.1 DnaJ 54..109 CDD:99751 21/54 (39%)
AT1G65280NP_001323409.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.