DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10375 and AT5G22080

DIOPT Version :9

Sequence 1:NP_651185.1 Gene:CG10375 / 42812 FlyBaseID:FBgn0039116 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_680194.1 Gene:AT5G22080 / 832269 AraportID:AT5G22080 Length:246 Species:Arabidopsis thaliana


Alignment Length:246 Identity:84/246 - (34%)
Similarity:133/246 - (54%) Gaps:37/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EEFYTEVKEIEKRDSVLTPSQQIDRLLRPGSTYFNLNPFEVLQIEPEVELADIKKRYRTLSILVH 82
            :.|..||.|:| ||:      ::.|:|    :.|.|||||.|.:..:....|:|::||.:|::||
plant    13 KSFLAEVGEVE-RDN------EVGRIL----SCFKLNPFEHLNLSFDSSTDDVKRQYRKISLMVH 66

  Fly    83 PDKNPDNQERAQMAFDIVSRSWKILENELTRKRCLEVYEEAKGRTDQMIAEKRKKLKK------- 140
            |||....|  ||.||..::::.::|.|:..|...|.....||   :::..:::|:|||       
plant    67 PDKCKHPQ--AQEAFGALAKAQQLLLNDQERDYILTQVHAAK---EELKMKRKKQLKKDTASKIK 126

  Fly   141 ----EGRPTEPIPEDDPTKYKHAIYVMVMKLFADMERRRQKLDQRDQEERKRKRETEIEEEERIK 201
                ||: .|.|.|.. .:::..:.:.|.::..|.|.||:|:..|..||..|.::.|.|::|..|
plant   127 SLVDEGK-HEHIYEQS-EEFQKELKLKVREILTDQEWRRRKMAMRISEEEGRLKKDEAEQKEIWK 189

  Fly   202 ADREWQQNFEESRQSRVNSWHDFQSGAGKSKKAKKQKHMTGMMVPPKFKPE 252
            ..||.::.:|.:|:.||:||.|||. ||  |||||     |...|||.|.|
plant   190 KKREHEEQWEGTREKRVSSWRDFQK-AG--KKAKK-----GETRPPKLKTE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10375NP_651185.1 DnaJ 54..109 CDD:99751 21/54 (39%)
AT5G22080NP_680194.1 DnaJ 38..91 CDD:99751 21/54 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1150
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2095
OMA 1 1.010 - - QHG57796
OrthoDB 1 1.010 - - D1434217at2759
OrthoFinder 1 1.000 - - FOG0005829
OrthoInspector 1 1.000 - - oto2942
orthoMCL 1 0.900 - - OOG6_103567
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.740

Return to query results.
Submit another query.