Sequence 1: | NP_651185.1 | Gene: | CG10375 / 42812 | FlyBaseID: | FBgn0039116 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_080453.2 | Gene: | Gpalpp1 / 67467 | MGIID: | 1914717 | Length: | 346 | Species: | Mus musculus |
Alignment Length: | 259 | Identity: | 65/259 - (25%) |
---|---|---|---|
Similarity: | 90/259 - (34%) | Gaps: | 89/259 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 SSSARDQPG--TSHDNFEEF-------------------YTEVKEIEKR-------------DSV 33
Fly 34 LTPSQQIDR-----LLRPGSTYFNLNP--FEVLQIEPEVELADIKKRYRTLSILVHPDKNPDNQE 91
Fly 92 RAQMAFDI-VSRSWKILENELT--RKRCLE---VYEEAKGRTDQMIAEKRKKLKKEGRPTEPIPE 150
Fly 151 DDPTKYKHAIYVMVMKLFADMERRRQKLDQRDQEERKRKRETEIEEEERIKADREWQQNFEESR 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10375 | NP_651185.1 | DnaJ | 54..109 | CDD:99751 | 13/57 (23%) |
Gpalpp1 | NP_080453.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..283 | 44/174 (25%) | |
GPALPP motif 1 | 7..12 | ||||
GPALPP motif 2 | 32..37 | ||||
GPALPP motif 3 | 91..96 | ||||
GPALPP motif 4 | 111..116 | ||||
DUF3752 | 210..338 | CDD:289349 | 44/165 (27%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 289..308 | 9/41 (22%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167847267 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |