DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10375 and Gpalpp1

DIOPT Version :9

Sequence 1:NP_651185.1 Gene:CG10375 / 42812 FlyBaseID:FBgn0039116 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_080453.2 Gene:Gpalpp1 / 67467 MGIID:1914717 Length:346 Species:Mus musculus


Alignment Length:259 Identity:65/259 - (25%)
Similarity:90/259 - (34%) Gaps:89/259 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSSARDQPG--TSHDNFEEF-------------------YTEVKEIEKR-------------DSV 33
            :...|:.||  :|..|.||.                   |:...|.|||             || 
Mouse   125 NDKGREDPGQVSSFFNSEEAESGEDEDIVGPMPAKGPVNYSVTTEFEKRAQRMKEKLTKGDDDS- 188

  Fly    34 LTPSQQIDR-----LLRPGSTYFNLNP--FEVLQIEPEVELADIKKRYRTLSILVHPDKNPDNQE 91
               |:.|.|     .|.|....|.|.|  |:        ..||.|...|:    |..|...|.:.
Mouse   189 ---SKPITRESWMTELPPEMKEFGLGPRTFK--------RRADDKSGDRS----VWTDTPADRER 238

  Fly    92 RAQMAFDI-VSRSWKILENELT--RKRCLE---VYEEAKGRTDQMIAEKRKKLKKEGRPTEPIPE 150
            :|:...:. .|.|.|..||.|:  .||..|   .|.|:| |::.::....||||.:.      .|
Mouse   239 KAKEIQEARKSFSKKDEENILSGRDKRLAEQVSSYNESK-RSESLMDIHHKKLKSKA------AE 296

  Fly   151 DDPTKYKHAIYVMVMKLFADMERRRQKLDQRDQEERKRKRETEIEEEERIKADREWQQNFEESR 214
            |   |.||              :.|...| || ::.|..|..|.:::..||..||....|...:
Mouse   297 D---KNKH--------------QERIPFD-RD-KDLKVNRFDEAQKKALIKKSRELNTRFSHGK 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10375NP_651185.1 DnaJ 54..109 CDD:99751 13/57 (23%)
Gpalpp1NP_080453.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..283 44/174 (25%)
GPALPP motif 1 7..12
GPALPP motif 2 32..37
GPALPP motif 3 91..96
GPALPP motif 4 111..116
DUF3752 210..338 CDD:289349 44/165 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..308 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.