DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10375 and Gpalpp1

DIOPT Version :9

Sequence 1:NP_651185.1 Gene:CG10375 / 42812 FlyBaseID:FBgn0039116 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001020046.1 Gene:Gpalpp1 / 298712 RGDID:1307254 Length:348 Species:Rattus norvegicus


Alignment Length:217 Identity:47/217 - (21%)
Similarity:78/217 - (35%) Gaps:62/217 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YTEVKEIEKRDSVLTPSQQIDRLLRPGSTYFNLNPFEV------LQIEPEVE-----------LA 68
            |:...|.|||      :|::...|..|.   :.:|..|      .::.||::           .|
  Rat   166 YSVTAEFEKR------AQRMKEKLTKGD---DDSPKPVTRESWMTELPPEMKDFGLGPRTFKRRA 221

  Fly    69 DIKKRYRTLSILVHPDKNPDNQERAQMAFDI-VSRSWKILENELT--RKRCLE---VYEEAKGRT 127
            |.|...|:    |..|...|.:.:|:...:. .|.|.|..||.|:  .||..|   .|.|:| |:
  Rat   222 DDKSGDRS----VWTDTPADRERKAKEIQEARKSLSKKDEENMLSGRDKRLAEQVSSYNESK-RS 281

  Fly   128 DQMIAEKRKKLKKEGRPTEPIPEDDPTKYKHAIYVMVMKLFADMERRRQKLDQRDQEERKRKRET 192
            :.::....|:||                         .|...|..|.:::......::.|..|..
  Rat   282 ESLMDIHHKRLK-------------------------TKAAEDKNRHQERTPFDRDKDLKVNRFD 321

  Fly   193 EIEEEERIKADREWQQNFEESR 214
            |.:::..||..||....|...:
  Rat   322 EAQKKALIKKSRELNTRFSHGK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10375NP_651185.1 DnaJ 54..109 CDD:99751 15/72 (21%)
Gpalpp1NP_001020046.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..163
GPALPP motif 1 7..12
GPALPP motif 2 32..37
GPALPP motif 3 93..98
GPALPP motif 4 113..118
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..317 34/172 (20%)
DUF3752 212..340 CDD:289349 34/157 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350792
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.