DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10375 and spf31

DIOPT Version :9

Sequence 1:NP_651185.1 Gene:CG10375 / 42812 FlyBaseID:FBgn0039116 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_595422.1 Gene:spf31 / 2539772 PomBaseID:SPBC1734.05c Length:209 Species:Schizosaccharomyces pombe


Alignment Length:218 Identity:67/218 - (30%)
Similarity:116/218 - (53%) Gaps:24/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KEIEKRDSVLTPSQQIDRLLRPGSTYFNLNPFEVLQIEPEVELADIKKRYRTLSILVHPDKNPDN 89
            |.:::.:..|...::|||:|    :.|.||.::||.|.|.:.:.||:..||..|:::|||||.||
pombe     6 KFLDRVEGSLNRGREIDRIL----SSFKLNAYDVLDILPGMSVDDIRNLYRKKSLMIHPDKNRDN 66

  Fly    90 QERAQMAFDIVSRSWKILENELTRKRCLEVYEEAKGRTDQMIAEKRKKLKKEGRPTEPIPEDDPT 154
            .:.|. ||||:.::...|.|:..|:.....|..|:   :|::.||:.....|...::....|...
pombe    67 PKAAD-AFDILKKAESDLVNDKIRESLDSAYTAAR---NQLLKEKKLSPNSEDVHSDQFLFDLKV 127

  Fly   155 KYKHAIYVMVMKLFAD--MERRRQKLDQRDQEERKRKRETEI--EEEERIKADREWQQNFEESRQ 215
            :::..       |.||  ..||.::||..:| :|::.|:.||  |.:.|:::::.|    ||:|.
pombe   128 RWREI-------LIADEVARRRARQLDLANQ-QREQARQDEIARERKRRVESEKVW----EETRD 180

  Fly   216 SRVNSWHDFQSGAGKSKKAKKQK 238
            :||.:|.||.....|:...||.|
pombe   181 NRVGNWQDFLHKTKKNNLKKKNK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10375NP_651185.1 DnaJ 54..109 CDD:99751 23/54 (43%)
spf31NP_595422.1 DnaJ 31..93 CDD:278647 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1150
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I1715
OMA 1 1.010 - - QHG57796
OrthoFinder 1 1.000 - - FOG0005829
OrthoInspector 1 1.000 - - oto102097
orthoMCL 1 0.900 - - OOG6_103567
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5362
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.760

Return to query results.
Submit another query.