DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10375 and dnajc14

DIOPT Version :9

Sequence 1:NP_651185.1 Gene:CG10375 / 42812 FlyBaseID:FBgn0039116 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_009304048.1 Gene:dnajc14 / 100535820 ZFINID:ZDB-GENE-121105-7 Length:657 Species:Danio rerio


Alignment Length:197 Identity:48/197 - (24%)
Similarity:78/197 - (39%) Gaps:54/197 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PSQQIDRLLR----PGSTYFNLNPFEVLQIEPEVELADIKKRYRTLSILVHPDKNPDNQERAQMA 96
            |.:::.|||.    |..   .|:||.||.::.....:::|:.||.|::.||||||  ....|..|
Zfish   348 PGEELQRLLALAKIPEE---ELDPFNVLGVDVHATESELKRAYRQLAVQVHPDKN--KHPGAGEA 407

  Fly    97 FDIVSRSWKILENELTRKRCLEVYEEAKGRTDQMIAEKRKKLKKEGRPTEPIPEDDPTKYKHAIY 161
            |.::..:|.|:.|..||:.    ||..:....::.....:.|.|        .:||   .|.|:.
Zfish   408 FKVLRAAWDIVSNPETRRE----YELKRMAATELSKSMNEFLTK--------LQDD---LKEAMN 457

  Fly   162 VMVMKLFADMERRRQKLDQRDQEERKRKRETEIE-EEERIKADREWQQNFEESRQSRVNSWHDFQ 225
            .|:.                          |:.| :.:|.:.|||   ..|....:..|.||..:
Zfish   458 TMMC--------------------------TKCEGKHKRFEMDRE---PGEARFCAECNKWHGAE 493

  Fly   226 SG 227
            .|
Zfish   494 EG 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10375NP_651185.1 DnaJ 54..109 CDD:99751 19/54 (35%)
dnajc14XP_009304048.1 DnaJ 367..428 CDD:278647 22/66 (33%)
Jiv90 458..544 CDD:291562 12/67 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.