DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10214 and rex2

DIOPT Version :9

Sequence 1:NP_651184.1 Gene:CG10214 / 42811 FlyBaseID:FBgn0039115 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_596699.2 Gene:rex2 / 2539853 PomBaseID:SPBC1347.07 Length:252 Species:Schizosaccharomyces pombe


Alignment Length:185 Identity:83/185 - (44%)
Similarity:118/185 - (63%) Gaps:6/185 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SNDRMSSTCGLDTDIVWMDLEMTGLDIEKDKILEVACIITDQDLNVKSEGPCFAINHPQEVYDSM 88
            ||.:||:   |...:||:|.|||||::.|..::|||.||||.:|....|.....|...::....|
pombe    69 SNLKMSN---LKQPLVWIDCEMTGLEVGKHVLMEVAAIITDGNLRPVEEKFDAVIKLDEKQLSEM 130

  Fly    89 NEWCMKHHYNSGLIDRCKSSDVNLEEASNLVLSYLEKNIP-KRACPLGGNSVYTDRLFIMKFMPL 152
            |:||::.|..|||.:||:.|::.:::..|.:|:|::|.|| ||...:.||||:.|..|:...||.
pombe   131 NDWCIEQHGKSGLTERCRQSNLTVKDVENQLLAYIKKYIPKKREALIAGNSVHADVRFLSVEMPK 195

  Fly   153 VDAYLHYRIVDVSTIKELAKRWHPAILDSAPKKSFTHRSLDDIRESIKELAYYKA 207
            :..:|||||:||||||||||||.|.|  .|..|...||:|.||.|||.||.:|::
pombe   196 IIEHLHYRIIDVSTIKELAKRWCPDI--PAYDKKGDHRALSDILESIGELQHYRS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10214NP_651184.1 Orn 38..210 CDD:99838 78/171 (46%)
rex2NP_596699.2 Orn 73..252 CDD:224860 81/181 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 139 1.000 Domainoid score I1219
eggNOG 1 0.900 - - E1_COG1949
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6447
Inparanoid 1 1.050 149 1.000 Inparanoid score I1312
OMA 1 1.010 - - QHG63397
OrthoFinder 1 1.000 - - FOG0003570
OrthoInspector 1 1.000 - - oto100856
orthoMCL 1 0.900 - - OOG6_103503
Panther 1 1.100 - - LDO PTHR11046
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R875
SonicParanoid 1 1.000 - - X2441
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.