DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10214 and C08B6.8

DIOPT Version :9

Sequence 1:NP_651184.1 Gene:CG10214 / 42811 FlyBaseID:FBgn0039115 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001256185.1 Gene:C08B6.8 / 179411 WormBaseID:WBGene00007429 Length:193 Species:Caenorhabditis elegans


Alignment Length:181 Identity:80/181 - (44%)
Similarity:118/181 - (65%) Gaps:3/181 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TCG-LDTDIVWMDLEMTGLDIEKDKILEVACIITDQDLNVKSEGPCFAINHPQEVYDSMNEWCMK 94
            ||. ::..|:|:|.||||||:||..:.|:|.|:||.:||..:.||...|:.|:||.|:|.||...
 Worm     7 TCDKIEQRIIWIDCEMTGLDVEKQTLCEIALIVTDSELNTIATGPDIVIHQPKEVLDNMEEWPRN 71

  Fly    95 HHYNSGLIDRCKSSDVNLEEASNLVLSYLEKNIPKRACPLGGNSVYTDRLFIMKFMPLVDAYLHY 159
            ..:.:||:::..:|..::.:|.|.|:.:|:.:......|:.|||:|.|||||.|:||.:|.:.||
 Worm    72 TFHENGLMEKIIASKYSMADAENEVIDFLKLHALPGKSPIAGNSIYMDRLFIKKYMPKLDKFAHY 136

  Fly   160 RIVDVSTIKELAKRWHPAILDSAPKKSFTHRSLDDIRESIKELAYYKANLF 210
            |.:||||||.|.:||:|..  ..|||..|||:.|||.|||.||..|:.::|
 Worm   137 RCIDVSTIKGLVQRWYPDY--KHPKKQCTHRAFDDIMESIAELKNYRESIF 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10214NP_651184.1 Orn 38..210 CDD:99838 77/171 (45%)
C08B6.8NP_001256185.1 Orn 15..185 CDD:99838 77/171 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167526
Domainoid 1 1.000 157 1.000 Domainoid score I2549
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6447
Inparanoid 1 1.050 166 1.000 Inparanoid score I2804
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63397
OrthoDB 1 1.010 - - D1079953at2759
OrthoFinder 1 1.000 - - FOG0003570
OrthoInspector 1 1.000 - - oto17514
orthoMCL 1 0.900 - - OOG6_103503
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R875
SonicParanoid 1 1.000 - - X2441
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.