DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10214 and Rexo2

DIOPT Version :9

Sequence 1:NP_651184.1 Gene:CG10214 / 42811 FlyBaseID:FBgn0039115 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_077195.2 Gene:Rexo2 / 104444 MGIID:1888981 Length:237 Species:Mus musculus


Alignment Length:174 Identity:95/174 - (54%)
Similarity:127/174 - (72%) Gaps:0/174 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IVWMDLEMTGLDIEKDKILEVACIITDQDLNVKSEGPCFAINHPQEVYDSMNEWCMKHHYNSGLI 102
            :||:||||||||||||:|:|:||:|||.|||:.:|||...|..|.|:.|||::||.:||..|||.
Mouse    43 MVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLT 107

  Fly   103 DRCKSSDVNLEEASNLVLSYLEKNIPKRACPLGGNSVYTDRLFIMKFMPLVDAYLHYRIVDVSTI 167
            ...|.|.|.|::|....||::.:..|...|||.||||:.|:.|:.|.||....:|||||:||||:
Mouse   108 KAVKESTVTLQQAEYEFLSFVRQQTPPGLCPLAGNSVHADKKFLDKHMPQFMKHLHYRIIDVSTV 172

  Fly   168 KELAKRWHPAILDSAPKKSFTHRSLDDIRESIKELAYYKANLFK 211
            |||.:||:|...:.||||:.:||:||||.||||||.:|:.|:||
Mouse   173 KELCRRWYPEDYEFAPKKAASHRALDDISESIKELQFYRNNIFK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10214NP_651184.1 Orn 38..210 CDD:99838 93/171 (54%)
Rexo2NP_077195.2 Orn 43..215 CDD:99838 93/171 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850383
Domainoid 1 1.000 194 1.000 Domainoid score I3172
eggNOG 1 0.900 - - E1_COG1949
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6447
Inparanoid 1 1.050 207 1.000 Inparanoid score I3701
Isobase 1 0.950 - 0 Normalized mean entropy S863
OMA 1 1.010 - - QHG63397
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003570
OrthoInspector 1 1.000 - - oto92753
orthoMCL 1 0.900 - - OOG6_103503
Panther 1 1.100 - - LDO PTHR11046
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R875
SonicParanoid 1 1.000 - - X2441
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.