DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-1 and Plin5

DIOPT Version :9

Sequence 1:NP_732904.2 Gene:Lsd-1 / 42810 FlyBaseID:FBgn0039114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001128109.1 Gene:Plin5 / 501283 RGDID:1589602 Length:475 Species:Rattus norvegicus


Alignment Length:357 Identity:67/357 - (18%)
Similarity:137/357 - (38%) Gaps:79/357 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IDRIGSIPLVESSVKRVETIYDKVKNNNRLFSWYFETAE----ATISAAYETIQPAVKLFEPSIQ 75
            :.|:.::|||.::...|...|:..|:.:.|.......||    :..:.|.:..||.::..:|.:.
  Rat    38 VKRVVALPLVRATCTAVSGAYNSAKDRHPLLGSACRFAEHCVCSVATCALDHAQPLLEHLQPKLA 102

  Fly    76 RLDNVMCKSLDILEQRIPLVYLPPEMMYWNTKEYMSDHLVRPV------------LKRADSVKQI 128
            .::::.|:.||.||:::|.:..|.:.:..:.|:.::..:...|            |:|  ||.|.
  Rat   103 TVNDLACRGLDKLEEKLPFLQQPSDTVVTSAKDAVAKSVTGVVDLAQRGRRWSGELRR--SVSQA 165

  Fly   129 GNAVLESPLTTYAAERIDGAFTVGDKFVDKYLVPIQTDQDQTDVKKLVSALNDNFSPIRQQLNRM 193
            .:.||...:    ::.:|......::.||.:|...:.:        ||:...::..|        
  Rat   166 MDTVLRRSV----SQAMDTVLGKSEELVDHFLPMTEAE--------LVALATESQGP-------- 210

  Fly   194 FGHKSPQEDDNEAVPDERGAIKAIHHGQRF-------SRKLKRRLTQRTIAEARALKKQSKEAIH 251
                            |.|:::.....|.:       |.:|:....|.::.:.|..|.:::|.:.
  Rat   211 ----------------EVGSVEEQRQKQGYFVRLGSLSARLRHLAYQHSLGKLRESKHRTQEMLA 259

  Fly   252 VLFYAAELI-------ATDPKQAVQKAKEL---WVYLSADEP--ENQARPATLEQLIVLLTRESA 304
            .|....|||       :..|.....|.:||   |      .|  ||..|.:.:|...:.|:|...
  Rat   260 QLQKTLELIQHMQSRASPTPTFHHPKVQELCGDW------SPCLENGYRHSQVELETLALSRSLT 318

  Fly   305 RRVVHLVNFSAHVAANIPRNLAHTTTEVAHHI 336
            ..:...|:..|.....:|.:......||...:
  Rat   319 LELQSAVDALAGCVRGLPPSAQAKVAEVQRSV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-1NP_732904.2 Perilipin 14..>295 CDD:281086 60/314 (19%)
Plin5NP_001128109.1 Essential for lipid droplet targeting. /evidence=ECO:0000250 1..200 34/175 (19%)
Interaction with LIPE. /evidence=ECO:0000250 1..123 20/84 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Perilipin 31..409 CDD:397257 67/357 (19%)
Interaction with PNPLA2 and ABHD5. /evidence=ECO:0000250 212..475 29/145 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 447..475
Recruits mitochondria at the lipid droplet surface. /evidence=ECO:0000250 456..475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437332at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14024
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.