DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-1 and zgc:77486

DIOPT Version :9

Sequence 1:NP_732904.2 Gene:Lsd-1 / 42810 FlyBaseID:FBgn0039114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_998037.1 Gene:zgc:77486 / 405808 ZFINID:ZDB-GENE-040426-2056 Length:238 Species:Danio rerio


Alignment Length:166 Identity:34/166 - (20%)
Similarity:61/166 - (36%) Gaps:34/166 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 PIQTDQDQTDVKKLVSALNDNFSPIRQQLNRM----------FGHKSPQEDDNEAVPDERG---- 212
            |:.|.:..|..::..|:.:.  ||:.||:..|          ......:|::.|......|    
Zfish    73 PLPTTEAGTPTEERTSSSSP--SPVTQQMTAMSISQDTATTDSDRAEVEEEEEEGSSKSTGPVGE 135

  Fly   213 AIKAIHHGQRFSRKLKRRLTQRTIAEARALKKQSKEAIHVLFYA--AELIATDPKQAVQKAKELW 275
            |.:|...|.:...|.|::....|..:...|..:|:....|.|..  |.:::.:..|.|:|     
Zfish   136 AAQASSDGDQTPDKNKKKNRCFTCRKKVGLTGKSQGKSFVFFNKGWAFILSMNRLQDVKK----- 195

  Fly   276 VYLSADEPENQARPATLEQLIVLLTRESARRVVHLV 311
                       :|.|..|....:|.|||...:..|:
Zfish   196 -----------SRFAAKEVNFNVLLRESTNILCSLI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-1NP_732904.2 Perilipin 14..>295 CDD:281086 29/148 (20%)
zgc:77486NP_998037.1 zf-A20 12..35 CDD:280010
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14024
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.