DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-1 and Lsd-2

DIOPT Version :9

Sequence 1:NP_732904.2 Gene:Lsd-1 / 42810 FlyBaseID:FBgn0039114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_572996.1 Gene:Lsd-2 / 32437 FlyBaseID:FBgn0030608 Length:352 Species:Drosophila melanogaster


Alignment Length:288 Identity:67/288 - (23%)
Similarity:122/288 - (42%) Gaps:52/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TSGSGL----------------HLEAIDRIGSIPLVESSVKRVETIYDKVKNNNRLFSWYFETAE 53
            |:|:|.                |||:::||..:|:|.::..:.:.:|.|||..||:|.|....||
  Fly    14 TTGNGTAMNDVDQPKDAKDLLPHLESLERIIKLPVVNAAWDKSQDVYGKVKGKNRVFEWALTAAE 78

  Fly    54 ATISAAYETIQPAVKLFEPSIQRLDNVMCKSLDILEQRIPLVYLPPEMMYWNTKEYMSDHLVRPV 118
            ..::.|..|..|.|...:..|..:|..:.|.:|.||.:.|::...|:.:|...|..:.| :|:|.
  Fly    79 DCVTRAVTTAAPFVTKLDRPIAYVDQTLVKGIDKLEVKAPIIKDTPQEIYNQAKSKVID-VVQPH 142

  Fly   119 LKRADSVKQIG---------------NAVLESPLTTYAAERIDGAFTVGDKFVDKYLVPIQTDQD 168
            |:|....|..|               |.||.:...:.|...:|....:.::.::.|....::|.:
  Fly   143 LERVVKFKAAGQQKAASLKDLAWQKANEVLATQYGSLAVNGVDTTTALAERLLEYYFPKCESDVE 207

  Fly   169 QTDVKKLVSALNDNFSPIRQQLNRMFGHKSPQEDDNEAVPDERGAIKAIHHGQRFSRKLKRRLTQ 233
            :.         ||:      :.|.:..:....|:|......|...:..:....|.|.|:.||:.:
  Fly   208 ED---------NDD------KQNAVVQNGKSSENDMPVPASEDPVLHTVQTVGRLSNKISRRVYR 257

  Fly   234 RTIAEARALKKQSKEAIHVLFYAAELIA 261
            ..   :|.:|:..|..|:  .|.:.|||
  Fly   258 NV---SRQIKQVQKGNIN--DYLSSLIA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-1NP_732904.2 Perilipin 14..>295 CDD:281086 61/263 (23%)
Lsd-2NP_572996.1 Perilipin 40..>287 CDD:281086 61/262 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437332at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26384
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14024
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4632
SonicParanoid 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.