DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-1 and plin1

DIOPT Version :9

Sequence 1:NP_732904.2 Gene:Lsd-1 / 42810 FlyBaseID:FBgn0039114 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_021323484.1 Gene:plin1 / 100034463 ZFINID:ZDB-GENE-050419-213 Length:467 Species:Danio rerio


Alignment Length:181 Identity:43/181 - (23%)
Similarity:81/181 - (44%) Gaps:27/181 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RIGSIPLVESSVKRVETIYDKVKNNNRLFSWYFETAEATISAAYE----TIQPAVKLFEPSIQRL 77
            ||.:|..|.::::.:|..|...|.::.:.|......|..:|.|..    :::||:.:.:|.:...
Zfish    20 RILNIRSVNAALESIEKTYTSTKQSHPIISSVCGLYEKGVSRAGNLAVWSMKPALHVLQPQLVAA 84

  Fly    78 DNVMCKSLDILEQRIPLVYLPPEMMYWNTKEYMSD--------------HLVRPVLKRADS-VKQ 127
            :::.||.||.||:::|.:..||..:..|.|..||.              |....||.:..| .:|
Zfish    85 NSMACKGLDRLEEKVPALQSPPAELAANIKGLMSSTLEAAKDGITCPIKHSSNVVLDKVSSRYQQ 149

  Fly   128 IGNA-------VLESPLTTYAAERIDGAFTVGDKFVDKYLVPIQTDQDQTD 171
            ..|.       :|.|.|...|.:|...|.::.:..:| .::|..:|:.:.|
Zfish   150 SKNTLSGGIQYILNSKLVFLAEQRASRALSLTENLID-CILPGTSDKTEND 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-1NP_732904.2 Perilipin 14..>295 CDD:281086 43/181 (24%)
plin1XP_021323484.1 Perilipin 15..332 CDD:308593 43/181 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437332at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14024
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.