DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhD and TIM18

DIOPT Version :9

Sequence 1:NP_651181.1 Gene:SdhD / 42808 FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_014940.4 Gene:TIM18 / 854472 SGDID:S000005823 Length:192 Species:Saccharomyces cerevisiae


Alignment Length:180 Identity:38/180 - (21%)
Similarity:73/180 - (40%) Gaps:38/180 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ITPLKSYSTLVANVQRKAVVQPLAVA---------------KI--VAPVVREISVSA-----PRM 66
            :.|:.:.||::.|..| ||...|.::               ||  :|...:|.|.|.     |..
Yeast     7 LKPVLNASTVIVNPVR-AVFPGLVLSTKRSFYSINRLNAENKINDIANTSKEASSSVQMFKPPEF 70

  Fly    67 ASAGSSHTLLWTVERIVSAGLLAVIPAAFIAP------SQVLDALMAISVVIHTHWGVEAMVVDY 125
            :....|:..  ..|||....|:.:....|.|.      :.:|||.::...:|:..:|..:.::||
Yeast    71 SQFKDSYQK--DYERIAKYTLIPLTMVPFYASFTGGVINPLLDASLSSIFLIYLQYGFTSCIIDY 133

  Fly   126 MRPSVVGNVLPKVAHIALIII---SVATLGGLFYFIQNDVGLANGIKRFW 172
                :.....|:...:||..:   |:.:|.|::.....:.|..:.:|:.|
Yeast   134 ----IPKEKYPRWHKLALYCLYGGSMLSLYGIYELETKNNGFVDLVKKLW 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 31/159 (19%)
TIM18NP_014940.4 CybS 47..180 CDD:368389 30/139 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344483
Domainoid 1 1.000 48 1.000 Domainoid score I2986
eggNOG 1 0.900 - - E1_KOG4097
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I1862
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103841
Panther 1 1.100 - - LDO PTHR13337
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.