DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhD and SHH4

DIOPT Version :9

Sequence 1:NP_651181.1 Gene:SdhD / 42808 FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_013265.1 Gene:SHH4 / 850861 SGDID:S000004154 Length:168 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:37/136 - (27%)
Similarity:62/136 - (45%) Gaps:15/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VAPVVREISVSAPRMASAGSSHTLLWTVERIVSAGLLAVI--PAAFIAP-SQVLDALMAISVVIH 113
            |:....:.|...|...:.||.|   |.|||.:|..:|.:|  |.....| |...|..:::.::.|
Yeast    39 VSGTANDSSYMPPESRAQGSYH---WIVERGLSLAVLPLIAVPLVTTGPISTFTDTFLSLVLLGH 100

  Fly   114 THWGVEAMVVDYMRPSVVGNVLPKVAHIALIIISVA---TLGGLFYFIQNDVGLANGIKRFWAIK 175
            .|.|.::.::||:...|.|    ||.|.|:.::|:.   :..|::.....:.||...:|..|  .
Yeast   101 CHIGFQSCIIDYISERVYG----KVHHYAMYLLSLGSFLSFVGIYKLESQEAGLIASLKSLW--D 159

  Fly   176 GKDAEK 181
            .|..||
Yeast   160 NKPVEK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 33/126 (26%)
SHH4NP_013265.1 CybS 26..159 CDD:368389 34/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I2986
eggNOG 1 0.900 - - E1_KOG4097
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I1862
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto100102
orthoMCL 1 0.900 - - OOG6_103841
Panther 1 1.100 - - O PTHR13337
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R310
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.850

Return to query results.
Submit another query.