DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhD and Sdhd

DIOPT Version :9

Sequence 1:NP_651181.1 Gene:SdhD / 42808 FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_080124.1 Gene:Sdhd / 66925 MGIID:1914175 Length:159 Species:Mus musculus


Alignment Length:186 Identity:55/186 - (29%)
Similarity:86/186 - (46%) Gaps:41/186 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSLLLRGAVRCNAANLVKSARITPLKSYSTLVANVQRKAVVQPLAVAKIVAPVVREISVSAPRMA 67
            :::||:..|.|:.    :.||           |.:.|..||:|..|:..:.        ..|...
Mouse     1 MAVLLKLGVLCSG----QGAR-----------ALLLRSRVVRPAYVSAFLQ--------DQPTQG 42

  Fly    68 SAGSSH--------------TLLWTVERIVSAGLLAVIPAAFIAPSQVLDALMAISVVIHTHWGV 118
            ..|:.|              :|.||.||:||..||.:|||.::.|..|:|..:|.::.:|:|||:
Mouse    43 RCGTQHIHLSPSHHSGSKAASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGL 107

  Fly   119 EAMVVDYMRPSVVGNVLPKVAHIALIIISVATLGGLFYFIQNDVGLANGIKRFWAI 174
            ..:|.||    |.|:.|||.|...|:.:|..|..||.||..:|||:...:...|.:
Mouse   108 GQVVTDY----VHGDTLPKAARAGLLALSALTFAGLCYFNYHDVGICRAVAMLWKL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 44/141 (31%)
SdhdNP_080124.1 SQR_TypeC_CybS 60..158 CDD:239576 39/101 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840102
Domainoid 1 1.000 87 1.000 Domainoid score I8014
eggNOG 1 0.900 - - E1_KOG4097
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5135
Isobase 1 0.950 - 0 Normalized mean entropy S6445
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006285
OrthoInspector 1 1.000 - - oto94708
orthoMCL 1 0.900 - - OOG6_103841
Panther 1 1.100 - - LDO PTHR13337
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R310
SonicParanoid 1 1.000 - - X5239
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.