DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhD and sdhda

DIOPT Version :9

Sequence 1:NP_651181.1 Gene:SdhD / 42808 FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001002489.1 Gene:sdhda / 436762 ZFINID:ZDB-GENE-040718-192 Length:154 Species:Danio rerio


Alignment Length:125 Identity:42/125 - (33%)
Similarity:68/125 - (54%) Gaps:10/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PVVREISVSAP------RMASAGSSHTLLWTVERIVSAGLLAVIPAAFIAPSQVLDALMAISVVI 112
            |.:.::..:.|      ..:|.|.|.:..||.||:::..||.:.|||::.|..|:|..:|.::.:
Zfish    32 PRIGDVDYTEPAGRIHTASSSTGISASQHWTGERVMTLVLLGMAPAAYLCPGPVVDYSIAAALTM 96

  Fly   113 HTHWGVEAMVVDYMRPSVVGNVLPKVAHIALIIISVATLGGLFYFIQNDVGLANGIKRFW 172
            |.|||:..::.||    |.|.|..|:|.:.:.::|.||..||.||..|||||...:...|
Zfish    97 HGHWGIGQVLTDY----VHGEVKIKLAKVGIFLLSTATFFGLCYFNYNDVGLCKAVVMLW 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 42/125 (34%)
sdhdaNP_001002489.1 SQR_TypeC_CybS 56..152 CDD:239576 37/99 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584269
Domainoid 1 1.000 81 1.000 Domainoid score I8467
eggNOG 1 0.900 - - E1_KOG4097
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5195
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1511215at2759
OrthoFinder 1 1.000 - - FOG0006285
OrthoInspector 1 1.000 - - otm24951
orthoMCL 1 0.900 - - OOG6_103841
Panther 1 1.100 - - O PTHR13337
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5239
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.