DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPMT1 and AT5G56610

DIOPT Version :9

Sequence 1:NP_651180.3 Gene:PTPMT1 / 42807 FlyBaseID:FBgn0039111 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_200472.2 Gene:AT5G56610 / 835762 AraportID:AT5G56610 Length:228 Species:Arabidopsis thaliana


Alignment Length:176 Identity:63/176 - (35%)
Similarity:95/176 - (53%) Gaps:20/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RVSFYPTLLYNVLMEKASAR-NWYDRIDEHVILGALPFRSQANDLIEKENMKAVVSMNEDYELTA 73
            |:.||||||||::..|..:: .|:|:|||::::||:|||.....| :|..:..|:::||.||...
plant    44 RILFYPTLLYNLVRFKLQSQFRWWDQIDEYLLMGAVPFRKDVPRL-KKLGVGGVITLNEPYETLV 107

  Fly    74 FSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLSSSYQPENVGSVY 138
            .|:....:.   :|.|.:.|.|...:|:...:...|.||:|...|.:               :.|
plant   108 PSSLYSAYE---MEHLVIPTRDYLFAPSIVDITLAVNFIHKNALLGK---------------TTY 154

  Fly   139 VHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRPHILLHTKQ 184
            |||||||.||.|:|.|||:.....|...|.:|:|..||.:|||..|
plant   155 VHCKAGRGRSTTVVLCYLIEHKSMTVAAAFEHVRSIRPRVLLHPSQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPMT1NP_651180.3 PTPMT1 31..194 CDD:350374 53/154 (34%)
AT5G56610NP_200472.2 PTPMT1 66..209 CDD:350374 53/154 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3627
eggNOG 1 0.900 - - E1_KOG1719
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11973
Inparanoid 1 1.050 103 1.000 Inparanoid score I2149
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386941at2759
OrthoFinder 1 1.000 - - FOG0005731
OrthoInspector 1 1.000 - - otm3118
orthoMCL 1 0.900 - - OOG6_104823
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4126
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.