DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPMT1 and AT2G35680

DIOPT Version :9

Sequence 1:NP_651180.3 Gene:PTPMT1 / 42807 FlyBaseID:FBgn0039111 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_565816.1 Gene:AT2G35680 / 818137 AraportID:AT2G35680 Length:337 Species:Arabidopsis thaliana


Alignment Length:185 Identity:68/185 - (36%)
Similarity:101/185 - (54%) Gaps:20/185 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ARVSFYPTLLYNVLMEKASAR-NWYDRIDEHVILGALPFRSQANDLIEKENMKAVVSMNEDYELT 72
            ||..|||||:|||:..|..:. .|:||:.|.::|||:||.|....|.|. .:..|:::||.||..
plant    50 ARALFYPTLVYNVVRNKLESEFRWWDRVAEFILLGAVPFPSDVPQLKEL-GVCGVITLNEPYETL 113

  Fly    73 AFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLSSSYQPENVGSV 137
            ..|:   .::...|:.|.:||.|...:|:.|.:.:.||||::...|.:               :.
plant   114 VPSS---LYKSYCIDHLVIATRDYCFAPSMEAICQAVEFIHRNASLGK---------------TT 160

  Fly   138 YVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRPHILLHTKQWDALRLFY 192
            ||||||||.||.|:|.|||:.....||:.|..::|..||.:||...||.|:..:|
plant   161 YVHCKAGRGRSTTIVICYLVQHKNMTPEAAYSYVRSIRPRVLLAAAQWKAVVEYY 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPMT1NP_651180.3 PTPMT1 31..194 CDD:350374 57/162 (35%)
AT2G35680NP_565816.1 PTPMT1 73..215 CDD:350374 56/160 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3627
eggNOG 1 0.900 - - E1_KOG1719
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I2149
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386941at2759
OrthoFinder 1 1.000 - - FOG0005731
OrthoInspector 1 1.000 - - otm3118
orthoMCL 1 0.900 - - OOG6_104823
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4126
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.