DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPMT1 and Dusp16

DIOPT Version :10

Sequence 1:NP_651180.3 Gene:PTPMT1 / 42807 FlyBaseID:FBgn0039111 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_569714.2 Gene:Dusp16 / 70686 MGIID:1917936 Length:660 Species:Mus musculus


Alignment Length:91 Identity:26/91 - (28%)
Similarity:41/91 - (45%) Gaps:15/91 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 FLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLSSSYQPENVGSVYVHCKAGRTRSATLV 152
            ||::...|.|.......|.:.|:||.|               ...:.|.|.:||.||.:||||:.
Mouse   206 FLRVPVNDSFCEKILPWLDKSVDFIEK---------------AKASNGCVLIHCLAGISRSATIA 255

  Fly   153 GCYLMMKNGWTPDQAVDHMRKCRPHI 178
            ..|:|.:...:.|:|...:::.||.|
Mouse   256 IAYIMKRMDMSLDEAYRFVKEKRPTI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPMT1NP_651180.3 PTPMT1 31..194 CDD:350374 26/91 (29%)
Dusp16NP_569714.2 DSP_MapKP 10..136 CDD:238723
PTP_DSP_cys 157..301 CDD:475123 26/91 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.