DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPMT1 and Mkp

DIOPT Version :9

Sequence 1:NP_651180.3 Gene:PTPMT1 / 42807 FlyBaseID:FBgn0039111 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001036572.1 Gene:Mkp / 4379907 FlyBaseID:FBgn0083992 Length:203 Species:Drosophila melanogaster


Alignment Length:67 Identity:20/67 - (29%)
Similarity:34/67 - (50%) Gaps:4/67 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 INKFLPLKQRIGGLSSSYQPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRP 176
            :|..||.....  :..:::.:  |.|.|||.||.:||.::|..|||.:.....:.|.:.::..||
  Fly   127 MNYILPASMEF--IEDAHRSQ--GCVLVHCNAGVSRSPSVVIGYLMQRRDMCYEDAYNLVKSWRP 187

  Fly   177 HI 178
            .|
  Fly   188 CI 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPMT1NP_651180.3 PTPMT1 31..194 CDD:350374 20/67 (30%)
MkpNP_001036572.1 DSPc 66..200 CDD:238073 20/67 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.