powered by:
Protein Alignment PTPMT1 and Mkp
DIOPT Version :9
Sequence 1: | NP_651180.3 |
Gene: | PTPMT1 / 42807 |
FlyBaseID: | FBgn0039111 |
Length: | 200 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001036572.1 |
Gene: | Mkp / 4379907 |
FlyBaseID: | FBgn0083992 |
Length: | 203 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 20/67 - (29%) |
Similarity: | 34/67 - (50%) |
Gaps: | 4/67 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 INKFLPLKQRIGGLSSSYQPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRP 176
:|..||..... :..:::.: |.|.|||.||.:||.::|..|||.:.....:.|.:.::..||
Fly 127 MNYILPASMEF--IEDAHRSQ--GCVLVHCNAGVSRSPSVVIGYLMQRRDMCYEDAYNLVKSWRP 187
Fly 177 HI 178
.|
Fly 188 CI 189
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
PTPMT1 | NP_651180.3 |
PTPMT1 |
31..194 |
CDD:350374 |
20/67 (30%) |
Mkp | NP_001036572.1 |
DSPc |
66..200 |
CDD:238073 |
20/67 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45462495 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.