DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPMT1 and CG15528

DIOPT Version :9

Sequence 1:NP_651180.3 Gene:PTPMT1 / 42807 FlyBaseID:FBgn0039111 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster


Alignment Length:190 Identity:45/190 - (23%)
Similarity:75/190 - (39%) Gaps:55/190 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VILGALPFRSQANDLIEKENMKAVVSMNEDYELTAF---SNNTEK-------------WRKLGIE 87
            :.:..:||   ||:.:|||:.:..:|.:...:.|.|   |..|..             ..|||:.
  Fly     9 IAISGVPF---ANETVEKESRQNQLSASTLEDHTPFPGLSRITPSLILCGAAAVVPAYMDKLGVS 70

  Fly    88 FL-----QLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGG-------LSSSYQP-----ENV- 134
            .:     :|..|.:   |:|:.            ||..||..       |:..:..     |.| 
  Fly    71 CVINVAPELPDTPL---PSQKN------------PLYLRIMAQDRSEVDLAKHFDEAADLIEEVH 120

  Fly   135 ---GSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRPHILLHTKQWDALRLF 191
               |...:||.||.:|||:|...|||...|.:..:|..|::..||.:..::..:..||.:
  Fly   121 LSGGCTLIHCVAGVSRSASLCLAYLMKHAGMSLREAYKHVQAIRPQVRPNSGFFQQLRRY 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPMT1NP_651180.3 PTPMT1 31..194 CDD:350374 45/190 (24%)
CG15528NP_651767.2 DSPc 43..181 CDD:238073 35/153 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.