DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPMT1 and ssh

DIOPT Version :9

Sequence 1:NP_651180.3 Gene:PTPMT1 / 42807 FlyBaseID:FBgn0039111 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster


Alignment Length:176 Identity:46/176 - (26%)
Similarity:69/176 - (39%) Gaps:51/176 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIDEHVILGALPFRSQANDLIEKENMKAVVSMNEDYELTAFSNNTEKWRKLGIEFLQLATTDIFE 98
            :|.|||.||     |:.|                       ::|.|:.:|.|:..:...|.:|  
  Fly   387 KIFEHVYLG-----SEWN-----------------------ASNLEELQKNGVRHILNVTREI-- 421

  Fly    99 SPNQEKLFRGV-EFIN-------KFLPLKQRIGGLSSSYQPENVGS-VYVHCKAGRTRSATLVGC 154
                :..|.|. |:.|       |...||..........:.:..|| |.||||.|.:|||::|..
  Fly   422 ----DNFFPGTFEYFNVRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIA 482

  Fly   155 YLMMKNGWTPDQAVDHMRKCRPHILLHTKQWDALRLFYTNNVETKS 200
            |.|....|...||::|::|.|..|..:..        :.|.:||.|
  Fly   483 YAMKAYQWEFQQALEHVKKRRSCIKPNKN--------FLNQLETYS 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPMT1NP_651180.3 PTPMT1 31..194 CDD:350374 42/168 (25%)
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 44/173 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.