DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPMT1 and Mkp3

DIOPT Version :9

Sequence 1:NP_651180.3 Gene:PTPMT1 / 42807 FlyBaseID:FBgn0039111 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster


Alignment Length:153 Identity:38/153 - (24%)
Similarity:66/153 - (43%) Gaps:30/153 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YDRIDEHVILGALPFRSQA-----NDLIEKENMKAVVSMNEDYELTAFSNNTEKWRKLG-IEFLQ 90
            |:.....:|.|.| |...|     ::.::|.|:|.|:::..|.        ..|:::.| |::||
  Fly   211 YNEAPVEIIPGLL-FLGNATHSCDSEALKKYNIKYVLNVTPDL--------PNKFKESGDIKYLQ 266

  Fly    91 LATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLSSSYQPENVGSVYVHCKAGRTRSATLVGCY 155
            :..||.:...........::||.:         ..|:|      ..|.|||.||.:||.|:...|
  Fly   267 IPITDHYSQDLAIHFPDAIQFIEE---------ARSAS------SVVLVHCLAGVSRSVTVTLAY 316

  Fly   156 LMMKNGWTPDQAVDHMRKCRPHI 178
            ||...|.:.:.|...:|..:|.:
  Fly   317 LMHTRGLSLNDAFAMVRDRKPDV 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPMT1NP_651180.3 PTPMT1 31..194 CDD:350374 38/153 (25%)
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 37/149 (25%)
CDC14 <242..359 CDD:225297 30/121 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.