DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPMT1 and cdc14

DIOPT Version :9

Sequence 1:NP_651180.3 Gene:PTPMT1 / 42807 FlyBaseID:FBgn0039111 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001285721.1 Gene:cdc14 / 34067 FlyBaseID:FBgn0031952 Length:1052 Species:Drosophila melanogaster


Alignment Length:130 Identity:35/130 - (26%)
Similarity:60/130 - (46%) Gaps:28/130 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NMKAVVSMN-EDYELTAFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQR 121
            |:..|:.:| :.|..::|.|       .|.:...|...| ..:|:.       ..:.|||.:.: 
  Fly   225 NVTTVIRLNAKVYHASSFEN-------AGFDHKDLFFID-GSTPSD-------AIMKKFLSICE- 273

  Fly   122 IGGLSSSYQPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRP-HILLHTKQW 185
                      ...|::.||||||..|:.:|:|.|:|...|:|..:|:..:|.||| .::.|.:||
  Fly   274 ----------TTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVIGHQQQW 328

  Fly   186  185
              Fly   329  328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPMT1NP_651180.3 PTPMT1 31..194 CDD:350374 35/130 (27%)
cdc14NP_001285721.1 DSPn 19..156 CDD:291343
PTPc 217..331 CDD:304379 35/130 (27%)
CDC14 <229..330 CDD:225297 34/126 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.