DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPMT1 and Ptpmt1

DIOPT Version :9

Sequence 1:NP_651180.3 Gene:PTPMT1 / 42807 FlyBaseID:FBgn0039111 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001099196.1 Gene:Ptpmt1 / 29390 RGDID:1589783 Length:251 Species:Rattus norvegicus


Alignment Length:190 Identity:78/190 - (41%)
Similarity:112/190 - (58%) Gaps:18/190 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AMFARVSFYPTLLYNVLMEKASA---RNWYDRIDEHVILGALPFRSQANDLIEKENMKAVVSMNE 67
            |..|||.|||||||.|...:...   |:||.|||..|:|||||.||....|:..||::.|::|||
  Rat    67 AGLARVLFYPTLLYTVFRGRVGGPAHRDWYHRIDHTVLLGALPLRSMTRRLVLDENVRGVITMNE 131

  Fly    68 DYELTAFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLSSSYQPE 132
            :||.....|.:::|:.:|:|.|:|:|.|:...|....|.|||:|..|:..|.|            
  Rat   132 EYETRFLCNTSKEWKNVGVEQLRLSTVDMTGVPTLANLHRGVQFALKYQSLGQ------------ 184

  Fly   133 NVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRPHILLHTKQWDALRLFY 192
               .|||||||||:||||:|..||:..:.|:|::|::.:.|.|.||.:...|.:.|:.|:
  Rat   185 ---CVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEILKEFH 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPMT1NP_651180.3 PTPMT1 31..194 CDD:350374 65/162 (40%)
Ptpmt1NP_001099196.1 PTPc 139..240 CDD:304379 42/115 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340697
Domainoid 1 1.000 92 1.000 Domainoid score I7460
eggNOG 1 0.900 - - E1_KOG1719
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11973
Inparanoid 1 1.050 150 1.000 Inparanoid score I4295
OMA 1 1.010 - - QHG48913
OrthoDB 1 1.010 - - D1386941at2759
OrthoFinder 1 1.000 - - FOG0005731
OrthoInspector 1 1.000 - - oto98318
orthoMCL 1 0.900 - - OOG6_104823
Panther 1 1.100 - - LDO PTHR46712
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4126
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.