DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPMT1 and DUSP1

DIOPT Version :10

Sequence 1:NP_651180.3 Gene:PTPMT1 / 42807 FlyBaseID:FBgn0039111 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_004408.1 Gene:DUSP1 / 1843 HGNCID:3064 Length:367 Species:Homo sapiens


Alignment Length:102 Identity:32/102 - (31%)
Similarity:47/102 - (46%) Gaps:17/102 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLSSSYQPENV----------GSVY 138
            |||      |..|..|.|....|.| .:..|.:|::.......||:..|.:          |.|:
Human   198 LGI------TALINVSANCPNHFEG-HYQYKSIPVEDNHKADISSWFNEAIDFIDSIKNAGGRVF 255

  Fly   139 VHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCR 175
            |||:||.:||||:...|||..|....|:|.:.:::.|
Human   256 VHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPMT1NP_651180.3 PTPMT1 31..194 CDD:350374 32/102 (31%)
DUSP1NP_004408.1 DSP_MapKP 7..136 CDD:238723
DSP_DUSP1 174..324 CDD:350486 32/102 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.