DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPMT1 and F28C6.8

DIOPT Version :9

Sequence 1:NP_651180.3 Gene:PTPMT1 / 42807 FlyBaseID:FBgn0039111 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001254161.1 Gene:F28C6.8 / 174381 WormBaseID:WBGene00009207 Length:189 Species:Caenorhabditis elegans


Alignment Length:206 Identity:72/206 - (34%)
Similarity:103/206 - (50%) Gaps:31/206 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MFARVSFYPTLLYNVLMEKASARN--WYDRIDEHVILGALPFRSQANDLIEKENMKAVVSMNEDY 69
            |...:.|||:|.||:.........  ||:|:||.:||||:||||..::||:|||:..||...|::
 Worm     1 MLTSLIFYPSLGYNLFRNYVQPNRWAWYNRVDETLILGAMPFRSMKDELIQKENVGGVVCCTEEF 65

  Fly    70 ELTAFSNNTEK--WRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLSSSYQPE 132
            ||.|..|...:  |:..|:||..:...|...:..:.::...||||                   |
 Worm    66 ELKAAMNAMREVDWKNEGVEFFAVPMKDFTGTAPRAEINEAVEFI-------------------E 111

  Fly   133 NVGS----VYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRPHILLHTKQWDAL----R 189
            :|.|    ||||||||||||||:..||||....|..:.|.:.::..|..:||....|..:    |
 Worm   112 SVASKGKTVYVHCKAGRTRSATVATCYLMKSRNWMSNVAWEFLKDKRHQVLLRNAHWRTVNEYRR 176

  Fly   190 LFYTNNVETKS 200
            ...:|:..|.|
 Worm   177 FLDSNSSSTGS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPMT1NP_651180.3 PTPMT1 31..194 CDD:350374 62/172 (36%)
F28C6.8NP_001254161.1 DSPc 49..175 CDD:279164 48/144 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159211
Domainoid 1 1.000 66 1.000 Domainoid score I6568
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11973
Inparanoid 1 1.050 116 1.000 Inparanoid score I3389
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48913
OrthoDB 1 1.010 - - D1386941at2759
OrthoFinder 1 1.000 - - FOG0005731
OrthoInspector 1 1.000 - - oto19776
orthoMCL 1 0.900 - - OOG6_104823
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3413
SonicParanoid 1 1.000 - - X4126
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.800

Return to query results.
Submit another query.