DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPMT1 and PTPMT1

DIOPT Version :9

Sequence 1:NP_651180.3 Gene:PTPMT1 / 42807 FlyBaseID:FBgn0039111 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_783859.1 Gene:PTPMT1 / 114971 HGNCID:26965 Length:201 Species:Homo sapiens


Alignment Length:190 Identity:79/190 - (41%)
Similarity:116/190 - (61%) Gaps:18/190 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AMFARVSFYPTLLYNVLMEKA---SARNWYDRIDEHVILGALPFRSQANDLIEKENMKAVVSMNE 67
            |..|||.|||||||.:...|.   :.|:||.|||..|:|||||.||....|::.||::.|::|||
Human     9 AGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNE 73

  Fly    68 DYELTAFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLSSSYQPE 132
            :||.....|::::|::||:|.|:|:|.|:...|..:.|.:||:|..|:..|.|            
Human    74 EYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQ------------ 126

  Fly   133 NVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRPHILLHTKQWDALRLFY 192
               .|||||||||:||||:|..||:..:.|:|::||..:.|.|.:|.:...|.|.|:.|:
Human   127 ---CVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFH 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPMT1NP_651180.3 PTPMT1 31..194 CDD:350374 66/162 (41%)
PTPMT1NP_783859.1 PTPc 40..182 CDD:304379 56/141 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147033
Domainoid 1 1.000 96 1.000 Domainoid score I7400
eggNOG 1 0.900 - - E1_KOG1719
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11973
Inparanoid 1 1.050 149 1.000 Inparanoid score I4387
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48913
OrthoDB 1 1.010 - - D1386941at2759
OrthoFinder 1 1.000 - - FOG0005731
OrthoInspector 1 1.000 - - oto91234
orthoMCL 1 0.900 - - OOG6_104823
Panther 1 1.100 - - LDO PTHR46712
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3413
SonicParanoid 1 1.000 - - X4126
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.