DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and AT1G45000

DIOPT Version :9

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_175120.1 Gene:AT1G45000 / 841065 AraportID:AT1G45000 Length:399 Species:Arabidopsis thaliana


Alignment Length:411 Identity:161/411 - (39%)
Similarity:244/411 - (59%) Gaps:24/411 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GEEVMRMSTDEIVS-RTRLMDNEIKIMKSEVIRITHEIQAQNEKIKDNTEKIKVNKTLPYLVSNV 82
            |::..|..|..:.. |.:|:.:  |.::|.|......::|..::.....:.:|..:::..::..|
plant     4 GDDAARRRTAAVTDYRKKLLHH--KELESRVRTARENLRAAKKEFNKTEDDLKSLQSVGQIIGEV 66

  Fly    83 IELLDVDPQEEEDDGSVTVLDNQRKGKCAVIKTSTRQAYFLPVIGLVDAEKLKPGDLVGVNKDSY 147
            :.                .|||:|    .::|.|:...|.:.....||.|||..|..|.::..:.
plant    67 LR----------------PLDNER----LIVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTL 111

  Fly   148 LILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFKNLGIHPPKGV 212
            .|:..||.|.|..|..|..::.....||.:|||..||:||.|::.||:.:.|.|..:||.|||||
plant   112 TIMRALPREVDPVVYNMLHEDPGNISYSAVGGLGDQIRELRESIELPLMNPELFLRVGIKPPKGV 176

  Fly   213 LLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDEL 277
            ||||||||||||||||.|:...:.|||:....::..:||:.|:|:|:.|..|:|..|.|||:||:
plant   177 LLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFNYAREHQPCIIFMDEI 241

  Fly   278 DAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIE 342
            ||||.:||....:.|||:|||::|||||||||.....:|:|.||||.|:|||||||.||||||||
plant   242 DAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIE 306

  Fly   343 FPHPNEEARARIMQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRSANSVTHE 407
            .|.|||::|..|::||:..:....::::|.:.:..:.||||..:.:|.||||.|:|...:.|.||
plant   307 IPLPNEQSRMEILKIHASGIAKHGEIDYEAIVKLGEGFNGADLRNICTEAGMFAIRAERDYVIHE 371

  Fly   408 DFMDAIMEV-QAKKKANLNYY 427
            |||.|:.:: :|||..:.::|
plant   372 DFMKAVRKLSEAKKLESSSHY 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 156/388 (40%)
AT1G45000NP_175120.1 RPT1 17..390 CDD:224143 157/394 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.