DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and AT5G20000

DIOPT Version :9

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_197500.1 Gene:AT5G20000 / 832122 AraportID:AT5G20000 Length:419 Species:Arabidopsis thaliana


Alignment Length:412 Identity:173/412 - (41%)
Similarity:248/412 - (60%) Gaps:61/412 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EESLGEEVMRMSTDEIVSRTRLMDNEIKIMK------SEVIRITHEIQAQNEKIKDNTEKIKVNK 73
            |:|.....:....:|:.||.|::..|:::::      .||:::          :..|...:||:.
plant    49 EKSYNLNRLEAQRNELNSRVRMLREELQLLQEPGSYVGEVVKV----------MGKNKVLVKVHP 103

  Fly    74 TLPYLVSNVIELLDVDPQEEEDDGSVTVLDNQRKGKCAVIKTSTRQAYFLPVIGLVDAEKLKPGD 138
            ...|:|       |:|..                                     :|..||.|..
plant   104 EGKYVV-------DIDKS-------------------------------------IDITKLTPST 124

  Fly   139 LVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFKN 203
            .|.:..|||::...||::.|..|..|:|::.|...|..|||||:||:|:.|.:.||:.|.|.|::
plant   125 RVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFES 189

  Fly   204 LGIHPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKA 268
            |||..||||||||||||||||||||.|..|..||::::|.:|||.:||:|:::||:.|.:|:|.|
plant   190 LGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHA 254

  Fly   269 PAIIFIDELDAIGTKRFDSEKA-GDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALL 332
            |:|||:||:|:||:.|.:|... ||.||||||||||||||||.::..|||:.||||:||||.|||
plant   255 PSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALL 319

  Fly   333 RSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIAL 397
            |.||:|||||||:||||:|..|::|||||||:...::.::::...:..:||:.||||.||||.||
plant   320 RPGRIDRKIEFPNPNEESRFDILKIHSRKMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFAL 384

  Fly   398 RRSANSVTHEDFMDAIMEVQAK 419
            |.....||.|||..|:.:|..|
plant   385 RERRVHVTQEDFEMAVAKVMKK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 169/394 (43%)
AT5G20000NP_197500.1 RPT1 34..417 CDD:224143 173/412 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.