DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and RPT6A

DIOPT Version :9

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001318606.1 Gene:RPT6A / 832121 AraportID:AT5G19990 Length:419 Species:Arabidopsis thaliana


Alignment Length:379 Identity:171/379 - (45%)
Similarity:251/379 - (66%) Gaps:7/379 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 MKSEVIRITHEIQAQNEKIKDNTEKIKVNKTLPYLVSNVIELLDVDPQEEEDDGSVT--VLDNQR 106
            :|...::..||:|.|..:..:|..:::..:.   .:::.:.:|..:.|..::.||..  |:....
plant    32 LKQYYLQHIHELQRQLRQKTNNLNRLEAQRN---ELNSRVRMLREELQLLQEPGSYVGEVVKVMG 93

  Fly   107 KGKCAVIKTSTRQAYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPT 171
            |.| .::|......|.:.:...:|..|:.|...|.:..|||::...||::.|..|..|:|::.|.
plant    94 KNK-VLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPD 157

  Fly   172 EQYSDIGGLDKQIQELIEAVVLPMTHKEKFKNLGIHPPKGVLLYGPPGTGKTLLARACAAQTKST 236
            ..|..|||||:||:|:.|.:.||:.|.|.|::|||..||||||||||||||||||||.|..|..|
plant   158 STYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCT 222

  Fly   237 FLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKA-GDREVQRTML 300
            |::::|.:|||.:||:|:::||:.|.:|:|.||:|||:||:|:||:.|.:|... ||.|||||||
plant   223 FIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTML 287

  Fly   301 ELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVS 365
            |||||||||.::..|||:.||||:||||.||||.||:|||||||:||||:|..|::|||||||:.
plant   288 ELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMNLM 352

  Fly   366 NDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRSANSVTHEDFMDAIMEVQAK 419
            ..::.::::...:..:||:.||||.||||.|||.....||.|||..|:.:|..|
plant   353 RGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 171/379 (45%)
RPT6ANP_001318606.1 RPT1 30..417 CDD:224143 171/379 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.