DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and AT3G15120

DIOPT Version :10

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001327597.1 Gene:AT3G15120 / 820743 AraportID:AT3G15120 Length:1964 Species:Arabidopsis thaliana


Alignment Length:272 Identity:94/272 - (34%)
Similarity:143/272 - (52%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 EQYSDIGGLDKQIQELIEAVVLPMTHKEKFKNLGIHPPKGVLLYGPPGTGKTLLARA-----CAA 231
            |.:..:.||:...|.:.|.|::|:.:.|.|.|||:.||:|:||:|.|||||||:.||     ...
plant   726 EGWDSVAGLEGVTQCMKEVVLIPLLYPEFFDNLGLTPPRGILLHGHPGTGKTLVVRALIGSLARG 790

  Fly   232 QTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQ 296
            ..:..:....|...:..::||..:.:|..|.:|::..|:|||.||:|.:..||...:......|.
plant   791 NRRIAYFARKGADCLGKYVGDAERQLRLLFQVAEKCQPSIIFFDEIDGLAPKRSRQQDQTHSSVV 855

  Fly   297 RTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRK 361
            .|:|.|   |||..|...:.||.|||..|.:||||.|.||.||:|.||.|:.:.||.|:.:|:||
plant   856 STLLAL---LDGLKSRGSVVVIGATNYPDAIDPALRRPGRFDREIYFPLPSVDDRAAIISLHTRK 917

  Fly   362 --MNVSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRS-----------------------A 401
              ..||..: .:.:::.|..|.||..:|:|.:|.||||.||                       :
plant   918 WPKPVSGYL-LKWIAKETAGFAGADIQALCTQAAMIALNRSFPLQESLAAAELGVSSSNRAALPS 981

  Fly   402 NSVTHEDFMDAI 413
            .||...|:::|:
plant   982 FSVEERDWLEAL 993

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 PRK03992 28..421 CDD:179699 94/272 (35%)
AT3G15120NP_001327597.1 PTZ00121 <2..443 CDD:173412
PHD_SF 535..639 CDD:473978
P-loop containing Nucleoside Triphosphate Hydrolases 730..899 CDD:476819 65/171 (38%)
AAA_lid_3 927..>958 CDD:465537 12/30 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.