DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and Psmc5

DIOPT Version :9

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_112411.1 Gene:Psmc5 / 81827 RGDID:708376 Length:406 Species:Rattus norvegicus


Alignment Length:412 Identity:181/412 - (43%)
Similarity:250/412 - (60%) Gaps:34/412 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EDGEESLGEEVMRMSTDEIVSRTRLMDNEIKIMKSEVIRITHEIQAQ----NEKIKDNTEKIKVN 72
            |:|:...|.....:|.   :...:|:.|:    ||:.:|   .:|||    |.|::...|::::.
  Rat    12 EEGKAGSGLRQYYLSK---IEELQLIVND----KSQNLR---RLQAQRNELNAKVRLLREELQLL 66

  Fly    73 KTLPYLVSNVIELLDVDPQEEEDDGSVTVLDNQRKGKCAVIKTSTRQAYFLPVIGLVDAEKLKPG 137
            :.....|..|:..:|                    .|..::|......:.:.|...:|...:.|.
  Rat    67 QEQGSYVGEVVRAMD--------------------KKKVLVKVHPEGKFVVDVDKNIDINDVTPN 111

  Fly   138 DLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFK 202
            ..|.:..|||.:.:.||.:.|..|..|.|::.|...|..||||||||:|:.|.:.||:.|.|.|:
  Rat   112 CRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFE 176

  Fly   203 NLGIHPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEK 267
            .|||..||||||||||||||||||||.|..|..||::::|.:|||.|||:||::||:.|.:|:|.
  Rat   177 ALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREH 241

  Fly   268 APAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALL 332
            ||:|||:||:|:||:.|.:....||.||||||||||||||||.:|.:||||.||||:||||.|||
  Rat   242 APSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALL 306

  Fly   333 RSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIAL 397
            |.||:|||||||.||||||..|::|||||||::..:|..:::......:||:.|.||.||||.||
  Rat   307 RPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYAL 371

  Fly   398 RRSANSVTHEDFMDAIMEVQAK 419
            |.....||.|||..|:.:|..|
  Rat   372 RERRVHVTQEDFEMAVAKVMQK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 177/391 (45%)
Psmc5NP_112411.1 RPT1 4..404 CDD:224143 181/412 (44%)
May mediate interaction with PRPF9. /evidence=ECO:0000250|UniProtKB:P62196 186..406 125/208 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.