DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and psmc1

DIOPT Version :9

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001039154.1 Gene:psmc1 / 733980 XenbaseID:XB-GENE-950579 Length:440 Species:Xenopus tropicalis


Alignment Length:398 Identity:183/398 - (45%)
Similarity:261/398 - (65%) Gaps:32/398 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RTRLMDNE-IK---IMKSEVIRITHEIQAQNEKIKDNTEKIKVNKTLPYLVSNVIELLDVDPQEE 93
            |.:|:..| ||   :|:.|.||...:::...||.::...|:...:..|..|..:.|::|      
 Frog    59 RLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIID------ 117

  Fly    94 EDDGSVTVLDNQRKGKCAVIKTSTRQAYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYD 158
                     ||.     |::.||....:::.::..||.:.|:||..|.:|...:.::..|..:.|
 Frog   118 ---------DNH-----AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTD 168

  Fly   159 ARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFKNLGIHPPKGVLLYGPPGTGKT 223
            ..|..|:|::.|.|.|:||||||.||||:.|:|.||:||.|.::.:||.|||||:||||||||||
 Frog   169 PLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKT 233

  Fly   224 LLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSE 288
            |||:|.|.||.:|||::.|.:|:|.::|||.||||:.|.:|:|.||:|:||||:|||||||:||.
 Frog   234 LLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSN 298

  Fly   289 KAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARAR 353
            ..|:||:||||||||||||||.|..|:|||.||||::.|||||:|.||:|||||||.|:|:.:.|
 Frog   299 SGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKR 363

  Fly   354 IMQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRSANSVTHEDFMDAIMEVQA 418
            |.|||:.:|.:::||..::|..:.||.:||..||:|.|||::|||.....||:|||        .
 Frog   364 IFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDF--------K 420

  Fly   419 KKKANLNY 426
            |.|.|:.|
 Frog   421 KSKENVLY 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 180/391 (46%)
psmc1NP_001039154.1 PTZ00361 1..440 CDD:185575 183/398 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.