DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and PSMC6

DIOPT Version :9

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_002797.4 Gene:PSMC6 / 5706 HGNCID:9553 Length:389 Species:Homo sapiens


Alignment Length:382 Identity:158/382 - (41%)
Similarity:236/382 - (61%) Gaps:13/382 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 QNEKIKDNTEKIKVNKTLPYLVSNVIE-LLDVDPQEEEDDGSVTVLDNQRKGKCAVIKTSTRQAY 121
            :::.::|..:|:..:|.:...:..:.| |.::..|.|:.:..:..|.:..:....|:|..|.:.:
Human     5 RDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKF 69

  Fly   122 FLP-------VIGL---VDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSD 176
            .:.       |:|.   :|..|||||..|.::..:..|:..||.|.|..|..|..::.....||:
Human    70 IVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSE 134

  Fly   177 IGGLDKQIQELIEAVVLPMTHKEKFKNLGIHPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLA 241
            ||||.:||:||.|.:.||:|:.|.|:.:||.||||.||||||||||||||||.|:|....|||:.
Human   135 IGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVV 199

  Fly   242 GPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQL 306
            ...:|..:||:.|:|:|:.|..|::..|.|||:||:||||.:||....:.|||:|||::|||||:
Human   200 SSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQM 264

  Fly   307 DGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSNDVNFE 371
            |||.:...:|:|.||||.|.|||||||.|||||||....|||:||..|::||:..:....::::|
Human   265 DGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYE 329

  Fly   372 ELSRSTDDFNGAQCKAVCVEAGMIALRRSANSVTHEDFMDAIMEVQAKKK--ANLNY 426
            .:.:.:|.||||..:.||.||||.|:|...:.|..||||.|:.:|...||  :.|:|
Human   330 AIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDY 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 154/373 (41%)
PSMC6NP_002797.4 RPT1 4..387 CDD:224143 158/382 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.