DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and PSMC5

DIOPT Version :9

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_024306608.1 Gene:PSMC5 / 5705 HGNCID:9552 Length:433 Species:Homo sapiens


Alignment Length:397 Identity:180/397 - (45%)
Similarity:255/397 - (64%) Gaps:21/397 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 MRMSTDEIVSRTRLMDNEIKIMKSEVIRITHEIQAQNEKIKDNTEKIKVNKTLPYLVSNVIELLD 87
            ::...:|:.::.||:..|:::::.:...:...::|.::|    ...:||:....::|       |
Human    45 LQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKK----KVLVKVHPEGKFVV-------D 98

  Fly    88 VDPQEEEDDGSVTVLDNQRKGKCAVIKTSTRQAYFLPVIGLVDAEKLKPGDLVGVNKDSYLILET 152
            ||...:.:|.||.       |:..|:..|   |..:|::.|....::.|...|.:..|||.:.:.
Human    99 VDKNIDINDVSVA-------GEVVVVVGS---ALTVPLLKLAPFTQVTPNCRVALRNDSYTLHKI 153

  Fly   153 LPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFKNLGIHPPKGVLLYGP 217
            ||.:.|..|..|.|::.|...|..||||||||:|:.|.:.||:.|.|.|:.|||..|||||||||
Human   154 LPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGP 218

  Fly   218 PGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGT 282
            |||||||||||.|..|..||::::|.:|||.|||:||::||:.|.:|:|.||:|||:||:|:||:
Human   219 PGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGS 283

  Fly   283 KRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPN 347
            .|.:....||.||||||||||||||||.:|.:||||.||||:||||.||||.||:|||||||.||
Human   284 SRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPN 348

  Fly   348 EEARARIMQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRSANSVTHEDFMDA 412
            ||||..|::|||||||::..:|..:::......:||:.|.||.||||.|||.....||.|||..|
Human   349 EEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMA 413

  Fly   413 IMEVQAK 419
            :.:|..|
Human   414 VAKVMQK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 179/387 (46%)
PSMC5XP_024306608.1 RPT1 4..431 CDD:224143 180/397 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.