DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and PSMC2

DIOPT Version :9

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_002794.1 Gene:PSMC2 / 5701 HGNCID:9548 Length:433 Species:Homo sapiens


Alignment Length:441 Identity:169/441 - (38%)
Similarity:250/441 - (56%) Gaps:48/441 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGEEVMRMSTDEIVSR-TRLMD-NEIKIMKS--------EVIRITHEIQAQNEKIKDNT------ 66
            ||.:..:...||...: .|.:| .:|.::|:        ::.::..:||...:||.:.|      
Human     5 LGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESD 69

  Fly    67 -------------EKIKVNKTLPYLVSNVIELLDVDPQEEEDDGSVTVLDNQRKGKCAVIKTSTR 118
                         :|..:....|..|:...::::.|.::.:                .:|.....
Human    70 TGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPK----------------YIINVKQF 118

  Fly   119 QAYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQ 183
            ..:.:.:...|....::.|..|||:::.|.|...||.:.|..|..|:|:|:|...|||:||..:|
Human   119 AKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQ 183

  Fly   184 IQELIEAVVLPMTHKEKFKNLGIHPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQM 248
            |::|.|.|..|:.|.|:|.||||.|||||||:|||||||||.|||.|.:|.:.|:::.|.:|||.
Human   184 IEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQK 248

  Fly   249 FIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTA 313
            ::|:||::||:.|.:|:.|...:||.||:||||..|||....||.|||||||||:||||||....
Human   249 YVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRG 313

  Fly   314 DIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSNDVNFEELSRSTD 378
            :|||:.||||.|.|||||:|.|||||||||..|:.|.|..|.:||:|.|:|..|:.||.|:|...
Human   314 NIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCP 378

  Fly   379 DFNGAQCKAVCVEAGMIALRRSANSVTHEDFMDAIMEV---QAKKKANLNY 426
            :..||:.::||.||||.|:|......|.:||::|:.:|   .||..|...|
Human   379 NSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKFSATPRY 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 163/419 (39%)
PSMC2NP_002794.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 4/16 (25%)
RPT1 23..430 CDD:224143 165/423 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.