DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and Rpt2

DIOPT Version :9

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster


Alignment Length:405 Identity:182/405 - (44%)
Similarity:262/405 - (64%) Gaps:28/405 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MSTDEIVSRTRLMDNEIKI--------MKSEVIRITHEIQAQNEKIKDNTEKIKVNKTLPYLVSN 81
            |...::...||.....:|:        |:.|.||....::.|:||.::...|:...:..|..|.|
  Fly    46 MKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEKNEEERSKVDDLRGTPMSVGN 110

  Fly    82 VIELLDVDPQEEEDDGSVTVLDNQRKGKCAVIKTSTRQAYFLPVIGLVDAEKLKPGDLVGVNKDS 146
            :.|::|               ||.     |::.||....:::.::..||.::|:||..|.:|...
  Fly   111 LEEIID---------------DNH-----AIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKV 155

  Fly   147 YLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFKNLGIHPPKG 211
            :.::..|..:.|..|..|::::.|.|.|:||||||.||||:.|:|.||:||.|.::.:||.||||
  Fly   156 HAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKG 220

  Fly   212 VLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDE 276
            |:|||||||||||||:|.|.||.:|||::.|.:|:|.::|||.||||:.|.:|:|.||:|:||||
  Fly   221 VILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDE 285

  Fly   277 LDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKI 341
            :||:||||:||...|:||:||||||||||||||.|..|:|||.||||::.|||||:|.||:||||
  Fly   286 IDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKI 350

  Fly   342 EFPHPNEEARARIMQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRSANSVTH 406
            |||.|:|:.:.||..||:.:|.::.|||..||..:.||.:||..||:|.|||::|||.....||:
  Fly   351 EFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTN 415

  Fly   407 EDFMDAIMEVQAKKK 421
            |||..:...|..:||
  Fly   416 EDFKKSKESVLYRKK 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 179/395 (45%)
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 182/405 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445418
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.