DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and psmc5

DIOPT Version :9

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_989358.1 Gene:psmc5 / 394988 XenbaseID:XB-GENE-999928 Length:414 Species:Xenopus tropicalis


Alignment Length:416 Identity:181/416 - (43%)
Similarity:253/416 - (60%) Gaps:40/416 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GEEVMRMSTDEIVSR----------TRLMDNEIKIM-KSEVIRITHEIQAQ----NEKIKDNTEK 68
            |:.:.:|..||  ||          :::.|.::.:. ||:.:|   .:|||    |.|::...|:
 Frog    11 GDGMEQMEMDE--SRGGIGLRQYYLSKIEDLQLVVNDKSQNLR---RLQAQRNELNAKVRLLREE 70

  Fly    69 IKVNKTLPYLVSNVIELLDVDPQEEEDDGSVTVLDNQRKGKCAVIKTSTRQAYFLPVIGLVDAEK 133
            :::.:.....|..|:..:|                    .|..::|......:.:.:...:|...
 Frog    71 LQLLQEQGSYVGEVVRAMD--------------------KKKVLVKVHPEGKFVVDIDKNIDIND 115

  Fly   134 LKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHK 198
            :.|...|.:..|||.:.:.||.:.|..|..|.|::.|...|..||||||||:|:.|.:.||:.|.
 Frog   116 VTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHP 180

  Fly   199 EKFKNLGIHPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFAL 263
            |.|:.|||..||||||||||||||||||||.|..|..||::::|.:|||.|||:||::||:.|.:
 Frog   181 ELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVM 245

  Fly   264 AKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILD 328
            |:|.||:|||:||:|:||:.|.:....||.||||||||||||||||.:|.:||||.||||:||||
 Frog   246 AREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILD 310

  Fly   329 PALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCVEAG 393
            .||||.||:|||||||.||||||..|::|||||||::..:|..:::......:||:.|.||.|||
 Frog   311 SALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAG 375

  Fly   394 MIALRRSANSVTHEDFMDAIMEVQAK 419
            |.|||.....||.|||..|:.:|..|
 Frog   376 MYALRERRVHVTQEDFEMAVAKVMQK 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 176/402 (44%)
psmc5NP_989358.1 RPT1 15..412 CDD:224143 180/412 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.