DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and Rpt4R

DIOPT Version :9

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001287039.1 Gene:Rpt4R / 39351 FlyBaseID:FBgn0036224 Length:398 Species:Drosophila melanogaster


Alignment Length:397 Identity:159/397 - (40%)
Similarity:241/397 - (60%) Gaps:26/397 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RTRLMDNEIKIMKSEVIRITHE-IQAQNEKIKDNTEKIKVNKTLPYLVSNVIELLDVDPQEEEDD 96
            ||:|:::.....|.:.:|..:: :.|:.||.:|:   :|..:::..:|..:::.|..|.      
  Fly    22 RTKLLEHREIESKLKALRDKYKVVNAEYEKSEDD---LKALQSVGQMVGEILKQLTPDN------ 77

  Fly    97 GSVTVLDNQRKGKCAVIKTSTRQAYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARV 161
                          .::|.|....|.:.....::.||||||..|.::..:..|:..||.|.|..|
  Fly    78 --------------FIVKASNGPRYVVGCRRQINKEKLKPGTRVALDVTTLTIMRYLPREVDPLV 128

  Fly   162 KAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFKNLGIHPPKGVLLYGPPGTGKTLLA 226
            ..|..::.....|::||||.:||:||.|.:.||:.:.:.|..:||.||||.||||||||||||||
  Fly   129 YNMTHEDPGNVNYAEIGGLGQQIRELREVIELPLLNPDIFLRVGISPPKGCLLYGPPGTGKTLLA 193

  Fly   227 RACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAG 291
            ||.|:|..:.|||:....:|..:||:.|:|:|:.||.|::..|.|||:||:||||.:||....:.
  Fly   194 RAIASQMDANFLKVVSSAIVDKYIGESARLIREMFAYARDHQPCIIFMDEIDAIGGRRFSEGTSA 258

  Fly   292 DREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQ 356
            |||:|||::|||||:|||.:...:|:|.||||.|.|||||||.||||||:|.|.|||.||..|::
  Fly   259 DREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKLEIPLPNEVARMDILK 323

  Fly   357 IHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRSANSVTHEDFMDAIMEVQAKKK 421
            ||:..:|...::::|.:.:.:|.||||..:.:|.|||:.|||.....|..||||.|:.::...||
  Fly   324 IHAEPLNKRGEIDYEAVVKLSDLFNGADLRNICTEAGLFALRCDREFVIQEDFMKAVRKIADNKK 388

  Fly   422 --ANLNY 426
              :.|:|
  Fly   389 LESRLDY 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 155/388 (40%)
Rpt4RNP_001287039.1 RPT1 13..396 CDD:224143 159/397 (40%)
AAA 180..312 CDD:278434 77/131 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445426
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.