DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and Rpt3

DIOPT Version :9

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001285108.1 Gene:Rpt3 / 32047 FlyBaseID:FBgn0028686 Length:413 Species:Drosophila melanogaster


Alignment Length:410 Identity:171/410 - (41%)
Similarity:246/410 - (60%) Gaps:48/410 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EDGEESLGEEVMRMSTDEIVSRTRLMDNEIKIMKSEVIRITHE-IQAQNEKIKDN---------- 65
            :|...||.|                :|.|...::.:.::.|.| |:.|.|.|||.          
  Fly    21 KDAHSSLDE----------------LDMEDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLH 69

  Fly    66 -TEKIKVNKTLPYLVSNVIELLDVDPQEEEDDGSVTVLDNQRKGKCAVIKTSTRQAYFLPVIGLV 129
             .|::|..:::|.::...:|.:|                 |..|   ::.::|...|::.::..:
  Fly    70 AQEEVKRIQSVPLVIGQFLEAVD-----------------QNTG---IVGSTTGSNYYVRILSTI 114

  Fly   130 DAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLP 194
            |.|.|||...|.::|.|..:::.||.|.|:.:..::.||:|...|:||||:|.|.||:.|||.||
  Fly   115 DRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPDEKPDVSYADIGGMDMQKQEIREAVELP 179

  Fly   195 MTHKEKFKNLGIHPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRD 259
            :||.|.:|.:||.||:|||:|||||.|||:||:|.|..|.::|:::.|.:.||.::|:|.::|||
  Fly   180 LTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRD 244

  Fly   260 AFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRV 324
            .|.||||.|||||||||:|||.|||||::...||||||.:||||||:|||..|.::|||.||||.
  Fly   245 VFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRA 309

  Fly   325 DILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVC 389
            |.|||||||.||||||||||.|:...:..:....:.|||:|.||:.||.....|..:||...|:|
  Fly   310 DTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAIC 374

  Fly   390 VEAGMIALRRSANSVTHEDF 409
            .||||.|:|.:...|..:||
  Fly   375 QEAGMHAVRENRYIVLAKDF 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 167/389 (43%)
Rpt3NP_001285108.1 PTZ00454 22..413 CDD:240423 171/409 (42%)
AAA 197..330 CDD:278434 86/132 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445419
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.