DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and rpt-4

DIOPT Version :9

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001022113.1 Gene:rpt-4 / 173384 WormBaseID:WBGene00004504 Length:406 Species:Caenorhabditis elegans


Alignment Length:399 Identity:158/399 - (39%)
Similarity:239/399 - (59%) Gaps:31/399 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VSRTRLMDNEIKIMKSEVIRITHEI-QAQNEKIKDNTEKIKVNKTLPYLVSNVIELLDVDPQEEE 94
            ::..|.::.::|.::.:...:|.:. :::|:        ||..:::..:|..|::.|    .||:
 Worm    33 LAECRDIEQKLKDLRKKESEMTKQFDKSEND--------IKSLQSVGQIVGEVLKQL----SEEK 85

  Fly    95 DDGSVTVLDNQRKGKCAVIKTSTRQAYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDA 159
                            .::|.:....|.:.....::.|:||.|..|.::..:..|:..||.|.|.
 Worm    86 ----------------FIVKATNGPRYVVGCRRSINKEELKQGTRVSLDMTTLTIMRQLPREVDP 134

  Fly   160 RVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFKNLGIHPPKGVLLYGPPGTGKTL 224
            .|..|..::.....|||:|||.:||:||.|.|.||:.:.|.||.:||.||||.||:|||||||||
 Worm   135 LVYKMSHEDPGNISYSDVGGLAEQIRELREVVELPLINPELFKRVGITPPKGCLLFGPPGTGKTL 199

  Fly   225 LARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEK 289
            ||||.|:|....|||:....:|..:||:.|:::|:.|..|::..|.|:|:||:||||.:||....
 Worm   200 LARAVASQLDCNFLKVVSSAIVDKYIGESARMIREMFNYARDHQPCIVFMDEIDAIGGRRFSEGT 264

  Fly   290 AGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARI 354
            :.|||:|||::|||||||||.|...:|||.||||.|.|||||||.||||||||...|||::|..|
 Worm   265 SADREIQRTLMELLNQLDGFDSLGKVKVIMATNRPDTLDPALLRPGRLDRKIEIGLPNEQSRLEI 329

  Fly   355 MQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRSANSVTHEDFMDAIMEV-QA 418
            ::|||.|:....:::||.:.:.:|.|:.|..:.||.||||.|:|.....|..||||.|:.:| .|
 Worm   330 LKIHSNKITKHGEIDFEAVVKLSDGFSAADLRNVCTEAGMFAIRAEREFVIDEDFMKAVRKVGDA 394

  Fly   419 KK-KANLNY 426
            |: :..|:|
 Worm   395 KRLETKLDY 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 156/390 (40%)
rpt-4NP_001022113.1 RPT1 21..404 CDD:224143 158/399 (40%)
AAA 188..320 CDD:278434 77/131 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.