DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt5 and Spg7

DIOPT Version :10

Sequence 1:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_310523.6 Gene:Spg7 / 1271665 VectorBaseID:AGAMI1_008609 Length:790 Species:Anopheles gambiae


Alignment Length:96 Identity:24/96 - (25%)
Similarity:32/96 - (33%) Gaps:26/96 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVNLFNSINGNGNAAKTGSNHSSNSERSNPRPPRKAYG-------------RLSGE-PDDSQSHQ 60
            :.:...|:|.:..|.|.   .|||:|....||   .||             ||.|. .||....|
Mosquito    18 STHTITSVNESRMAFKV---KSSNNEHYRVRP---VYGFVEARGKMKFEIIRLEGPVKDDKIMLQ 76

  Fly    61 RARYDVTGSSASPPYTVKLIDFDGAAGSETT 91
            .|......:.|..|:..      ||...:.|
Mosquito    77 YAEVPADETDAQAPFKA------GAQQGDVT 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt5NP_524464.1 PRK03992 28..421 CDD:179699 20/78 (26%)
Spg7XP_310523.6 None

Return to query results.
Submit another query.